Cheesy Ground Beef and Potato Casserole Recipe
30-MINUTE MEALS! Get the email series now
Royal Recipe

Cheesy Ground Beef and Potato Casserole

5 from 1 vote
1 Comments
Charlotte Anne
By: Charlotte AnneUpdated: Jul 16, 2026
This post may contain affiliate links. Please read our disclosure policy.

A warm, satisfying casserole layered with seasoned ground beef, tender diced russet potatoes, mixed vegetables, and a creamy cheddar sauce—perfect for family dinners and easy make-ahead meals.

Cheesy Ground Beef and Potato Casserole

This Cheesy Ground Beef and Potato Casserole has been a weeknight lifesaver in my kitchen for years. I first put these flavors together on a rainy Sunday when I had a pound of ground beef and a sack of russet potatoes to use up. The combination of browned beef, soft diced potatoes, and a rich, creamy mushroom-milk sauce topped with sharp cheddar filled the house with the kind of smell that makes everyone wander into the kitchen. It quickly became a requested dish for potlucks and busy evenings when I wanted something both comforting and uncomplicated.

The texture is what keeps people coming back: fork-tender potato cubes soaking up the sauce while still holding their shape, pockets of melted cheddar, and little bites of seasoned beef and mixed vegetables. I love that it’s forgiving; you can swap vegetables and adjust seasonings without losing the heartiness. It’s the sort of recipe that reminds me of family dinners growing up, where recipes were judged by whether they could feed a crowd and still taste great as leftovers.

Why You'll Love This Recipe

  • Comforting and filling: hearty potatoes and lean ground beef make this a complete one-dish meal that satisfies hungry families.
  • Simple ingredients: uses pantry staples like condensed cream of mushroom, milk, and shredded cheddar—easy to shop for.
  • Make-ahead friendly: assemble in advance and bake when ready, perfect for busy evenings or potluck contributions.
  • Quick to pull together: about 20 minutes active prep and hands-off baking time, great for weeknights.
  • Customizable: swap mixed vegetables, use different cheeses, or add herbs to suit dietary preferences.
  • Budget conscious: affordable ingredients deliver big flavor without a big grocery bill.

Personally, this dish became a household favorite the first time I served it to my partner and their friends. They all went back for seconds, and one friend asked for the recipe on the spot. It’s the kind of meal that creates those small, memorable moments—leftover sandwiches the next day are another highlight.

Ingredients

  • Russet potatoes (2 pounds, peeled and diced): Choose firm, dry russets for best structure. Dice into roughly 1/2- to 3/4-inch cubes so they cook through evenly. If using Yukon gold, reduce cook time slightly because they soften faster.
  • Lean ground beef (1 pound): 90% lean or leaner keeps richness without excessive grease. Ground sirloin or 93% lean are both great choices for good flavor and fewer drippings.
  • Onion (1 medium, chopped): Yellow onion provides balanced sweetness; white will be sharper. Chop fine so it melds into the meat.
  • Garlic (4 cloves, minced): Fresh garlic adds brightness—use more if you like a garlicky profile or swap 1 teaspoon garlic powder in a pinch.
  • Frozen mixed vegetables (1 cup): A simple blend of carrots, peas, and corn gives texture and color. Thaw slightly for even cooking.
  • Salt & pepper: Season lightly while cooking and adjust at the end. Remember the condensed soup adds salt, so taste before adding too much.
  • Condensed cream of mushroom soup (10.5 ounce can): This is the backbone of the sauce—adds savory depth and a silky body. For a lighter version, use low-sodium or mushroom broth plus a thickener.
  • Milk (1 cup, 2% recommended): Adds creaminess without being overly heavy. Whole milk will make the sauce richer; skim will thin it slightly.
  • Sour cream (1/2 cup): Gives tang and body—full-fat sour cream yields the creamiest result.
  • Worcestershire sauce (1 tablespoon): Adds umami and depth; do not skip for a rounded savory profile.
  • Italian seasoning (1 teaspoon): A simple herb blend that brightens the sauce; substitute 1/2 teaspoon dried thyme and 1/2 teaspoon dried oregano if preferred.
  • Shredded cheddar cheese (2 cups, divided): Sharp cheddar contrasts the creamy sauce. Grate a block for better melt and flavor than pre-shredded versions.

Instructions

Preheat oven: Preheat to 400°F and position the rack in the middle. A hot oven jump-starts the bake so the top browns nicely after the foil comes off. Allow the oven to reach temperature before inserting the casserole for consistent cooking. Prepare the potatoes: Add the peeled and diced potatoes directly to a greased 9x13-inch casserole dish. Cutting into uniform 1/2- to 3/4-inch cubes ensures they cook evenly; if pieces are larger, increase baking time and check for tenderness with a fork. Brown the beef and onions: Heat a large skillet over medium-high. Add the ground beef and chopped onion, breaking the meat apart as it cooks. Sauté until the beef is fully browned and onions are translucent, about 8 to 10 minutes. Drain excess fat if the pan pools grease to avoid a greasy final dish. Add garlic and vegetables: Stir in minced garlic and the frozen mixed vegetables; cook another 2 to 3 minutes until the garlic is fragrant and vegetables begin to warm through. Season with a modest pinch of salt and a few grinds of black pepper. Transfer this mixture over the potatoes in the casserole dish. Make the sauce: In a medium bowl combine the condensed cream of mushroom soup, 1 cup milk, 1/2 cup sour cream, 1 tablespoon Worcestershire sauce, 1 teaspoon Italian seasoning, and 1 cup (half) of the shredded cheddar. Whisk until smooth; the consistency should be pourable but creamy so it will coat potatoes and beef evenly. Assemble the casserole: Pour the sauce over the beef and potatoes. Stir gently with a large spoon in the dish so the potatoes, beef, and sauce are distributed in an even layer. Smooth the top; this ensures even baking and that the sauce seeps into the potato cubes. Bake covered: Tightly cover the dish with foil and bake for 45 minutes. The covered bake steams the potatoes and melds the flavors. If your potatoes were cut larger than 3/4 inch, check after 45 minutes and extend in 10-minute increments. Finish with cheese: Remove the foil, sprinkle the remaining 1 cup shredded cheddar evenly on top, and return uncovered. Bake for another 10 to 15 minutes or until the cheese melts and the potatoes are fork-tender. If you prefer a golden-brown crust, broil for 1 to 2 minutes while watching closely. Rest and serve: Let the casserole rest for 5 to 10 minutes before serving; this helps the sauce thicken and makes it easier to portion. Taste and season with extra salt and pepper if needed. User provided content image 1

You Must Know

  • This dish stores well in the refrigerator for up to 4 days when covered tightly in an airtight container.
  • It freezes well for up to 3 months; thaw overnight in the fridge before reheating to maintain texture.
  • Because condensed soup and cheddar add salt, taste before adding extra salt at the end.
  • Using uniform potato cubes and a middle oven rack position ensures even cooking throughout the dish.

My favorite thing about this casserole is how reliably it comforts. It has rescued many busy weeknights and always makes enough for generous leftovers. Once, for a small family gathering, I doubled the recipe and baked two pans; everyone took home containers and wrote down the recipe. The reheated slices are excellent for lunches, and a quick blast under the broiler restores the fresh-baked top beautifully.

User provided content image 2

Storage Tips

Cool the casserole to near room temperature before refrigerating to avoid raising the fridge temperature. Store in an airtight container or cover tightly with foil or plastic wrap. Refrigerated portions keep well for up to 4 days. For freezing, wrap the cooled casserole tightly in plastic wrap and then foil, or transfer portions to freezer-safe containers for up to 3 months. When reheating, thaw overnight in the refrigerator for best results, then reheat in a 350°F oven for 20 to 30 minutes until warmed through. Leftover slices re-crisp nicely under the broiler for 1 to 3 minutes—watch closely to prevent burning.

Ingredient Substitutions

If you need lower sodium, choose a low-sodium condensed mushroom soup or use 1 cup mushroom broth plus 2 tablespoons of cornstarch to thicken. Swap ground turkey or ground chicken for beef to reduce fat; add 1 tablespoon soy sauce or Worcestershire for extra umami. Replace sour cream with plain Greek yogurt for tang and extra protein. For a gluten-free version, confirm the condensed soup is labeled gluten-free or use homemade mushroom sauce. If you prefer a lighter potato, substitute 2 pounds of peeled sweet potatoes for a slightly sweeter profile; adjust baking time as needed.

Serving Suggestions

Serve this casserole straight from the pan with a crisp green salad and a simple vinaigrette to cut through the richness. For a heartier meal, pair with steamed green beans or roasted Brussels sprouts. Garnish with chopped fresh parsley or chives for a burst of color and freshness. It also makes a comforting side for holiday tables—slice into squares and offer alongside roasted meats. Leftovers make excellent sandwich fillings; pile a spoonful between potato bread and toast gently for a melty, indulgent lunch.

Cultural Background

This style of layered, creamy casserole has roots in mid-20th-century American home cooking where convenience products like condensed soups became pantry staples. The technique—brown a protein, combine with a starch and a binder, then bake—reflects a practical approach to feeding families with minimal fuss. Regional variations across the U.S. add different cheeses, vegetables, or seasonings; in some Midwestern households, tater tots or hash browns appear on top for texture. The comfort-food nature of this dish mirrors casseroles served in many cultures, adapted to available local ingredients and tastes.

Seasonal Adaptations

In winter, use root vegetables like parsnip or rutabaga mixed with potatoes for earthier flavors. Spring and summer allow swapping frozen mixed vegetables for fresh peas, corn, and diced bell pepper to brighten the dish. For holiday gatherings, fold in roasted mushrooms and shallots and use smoked cheddar to elevate the flavor. In warmer months, reduce baking time slightly and serve alongside a chilled slaw for contrast. Adjust herbs seasonally—fresh thyme in winter, basil in summer—for subtle changes that make the recipe feel new.

Meal Prep Tips

Assemble the casserole in a 9x13 pan up to 24 hours ahead and refrigerate covered; bring to room temperature for 20 minutes before baking to avoid long cold spots. For single-serve meal prep, portion into individual foil containers and freeze; reheat for 25 to 30 minutes at 350°F or until hot. Keep shredded cheese separate until the final bake to prevent it from seeping into the sauce during storage. Label containers with reheating instructions and date to maintain freshness and prevent overcooking during reheat.

There’s a simple joy in serving something comforting that everyone recognizes and loves. This casserole is an adaptable, forgiving meal that invites creativity while delivering consistent comfort. Make it your own, and don’t be surprised if it becomes a new family favorite.

Pro Tips

  • Cut potatoes into even 1/2- to 3/4-inch cubes so they cook evenly with the beef and sauce.

  • Drain excess fat after browning the meat to prevent a greasy final texture and to reduce splatter when adding the soup mixture.

  • Let the casserole rest 5 to 10 minutes before serving; this lets the sauce thicken and makes slicing cleaner.

  • Use block cheddar and grate it yourself for better melt and no anti-caking agents.

  • If potatoes are larger than recommended, par-cook them in boiling water for 5 minutes to ensure they become tender in the baking window.

This nourishing cheesy ground beef and potato casserole recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

Can I prepare the casserole ahead of time?

Yes. This can be assembled and refrigerated for up to 24 hours before baking. Cover tightly and bake according to instructions, checking for potato tenderness.

Can this be frozen?

Yes. Freeze the baked casserole up to 3 months. Thaw overnight in the refrigerator and reheat at 350°F until warmed through.

Tags

Winter Warmers dinnercasserolepotatoesground-beefcheesyweeknightfamily-friendlyrecipes
No ratings yet

Cheesy Ground Beef and Potato Casserole

This Cheesy Ground Beef and Potato Casserole recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 6 steaks
Cheesy Ground Beef and Potato Casserole
Prep:20 minutes
Cook:1 hour
Rest Time:10 mins
Total:1 hour 20 minutes

Instructions

1

Preheat oven

Preheat the oven to 400°F and move the rack to the middle position so the casserole bakes evenly.

2

Prepare potatoes

Peel and dice potatoes into 1/2- to 3/4-inch cubes and place them in a greased 9x13-inch casserole dish to form the base layer.

3

Brown beef and onions

In a large skillet over medium-high heat, cook the ground beef and chopped onion for 8 to 10 minutes until browned. Drain excess fat if necessary.

4

Add garlic and vegetables

Stir in minced garlic and frozen mixed vegetables; cook 2 to 3 minutes more until fragrant, then season lightly and transfer to the casserole dish over the potatoes.

5

Make creamy sauce

Whisk the condensed soup, milk, sour cream, Worcestershire sauce, Italian seasoning, and half the cheddar together until smooth and pourable.

6

Assemble and bake covered

Pour the sauce over the beef and potatoes in the dish, stir gently to distribute, cover tightly with foil, and bake 45 minutes.

7

Finish baking

Remove foil, top with remaining cheddar, and bake uncovered 10 to 15 minutes until cheese melts and potatoes are tender. Let rest 5 to 10 minutes before serving.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 534kcal | Carbohydrates: 35g | Protein:
28g | Fat: 28g | Saturated Fat: 8g |
Polyunsaturated Fat: 6g | Monounsaturated Fat:
11g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@gusteen on social media!

Cheesy Ground Beef and Potato Casserole

Categories:

Cheesy Ground Beef and Potato Casserole

Did You Make This?

Leave a comment & rating below or tag @gusteen on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Charlotte!

Chef and recipe creator specializing in delicious Winter Warmers cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.